PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10003695m
Common NameCARUB_v10003695mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 438aa    MW: 49331.1 Da    PI: 8.2298
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10003695mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.4e-18113159148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd +l+++vkq+G + W+ I++++  gR +kqc++rw+++l
  Carubv10003695m 113 KGQWTAEEDRKLIKLVKQHGDRKWAIISEKLE-GRAGKQCRERWHNHL 159
                      799*****************************.*************97 PP

2Myb_DNA-binding544e-17165207145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W++eE+  +v+a+++ G++ W+ Ia+ ++ gRt++++k++w+
  Carubv10003695m 165 KDSWSEEEERVFVEAHTRIGNK-WAEIAKLIQ-GRTENSIKNHWN 207
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.224108163IPR017930Myb domain
SuperFamilySSF466892.08E-28110206IPR009057Homeodomain-like
SMARTSM007172.9E-16112161IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-26114166IPR009057Homeodomain-like
CDDcd001671.19E-14116159No hitNo description
PfamPF139213.1E-19116173No hitNo description
SMARTSM007171.2E-13164212IPR001005SANT/Myb domain
PROSITE profilePS5129418.914164214IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-19167212IPR009057Homeodomain-like
CDDcd001677.70E-10167210No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MEDQGTQEKS LAHCAAPPLT AVERFLNSQK NDTLCFKTQE RSTDRPILKT TRATEIRKDN  60
KQNMMFGPRK EKNLAVNNGN RNVIGEMIVK GGTTRDYQKS TNCKKRPYKN LIKGQWTAEE  120
DRKLIKLVKQ HGDRKWAIIS EKLEGRAGKQ CRERWHNHLR PDIKKDSWSE EEERVFVEAH  180
TRIGNKWAEI AKLIQGRTEN SIKNHWNATK RRQNSKRKHK RSRNADSTNS DVDDLSPSAK  240
RPCILEDYIR SVDNNDKGNG QNIITATGGS NIFLSTPNLE DVDSTSSLLD DPYDEELIFL  300
KNIFANHPVS LENMDLSQGS DEITQSSSSG FMFKNPNPKP NLHNNIVGNQ LGTMVTEPAI  360
TSHLASDIYL SDLLDGTASS SSLSFMSSNN SSEHAAENEL FVPQANSTSE RREMDLMEML  420
SGSSTIGSTS NIWFPLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-451112132104C-Myb DNA-Binding Domain
1mse_C3e-451112132104C-Myb DNA-Binding Domain
1gv2_A3e-451112132104MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-4411121356158MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-4411121356158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1209220KRRQNSKRKHKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006290059.10.0hypothetical protein CARUB_v10003695mg
TrEMBLR0FKF00.0R0FKF0_9BRAS; Uncharacterized protein
STRINGAT5G11050.10.0(Arabidopsis thaliana)
STRINGfgenesh2_kg.6__1071__AT5G11050.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42652656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11050.10.0myb domain protein 64